Bio.Structure: Macromolecular Structures
The Bio.Structure
module provides functionality to manipulate macromolecular structures, and in particular to read and write Protein Data Bank (PDB) files. It is designed to be used for standard structural analysis tasks, as well as acting as a platform on which others can build to create more specific tools. It compares favourably in terms of performance to other PDB parsers - see some benchmarks.
Parsing PDB files
To download a PDB file:
downloadpdb("1EN2")
To parse a PDB file into a Structure-Model-Chain-Residue-Atom framework:
julia> struc = read(filepath_1EN2, PDB) Bio.Structure.ProteinStructure Name - 1EN2.pdb Number of models - 1 Chain(s) - A Number of residues - 85 Number of point mutations - 5 Number of other molecules - 5 Number of water molecules - 76 Number of atoms - 614 Number of hydrogens - 0 Number of disordered atoms - 27
The elements of struc
can be accessed as follows:
Command | Returns | Return type |
---|---|---|
struc[1] |
Model 1 | Model |
struc[1]['A'] |
Model 1, chain A | Chain |
struc['A'] |
The lowest model (model 1), chain A | Chain |
struc['A']["50"] |
Model 1, chain A, residue 50 | AbstractResidue |
struc['A'][50] |
Shortcut to above if it is not a hetero residue and the insertion code is blank | AbstractResidue |
struc['A']["H_90"] |
Model 1, chain A, hetero residue 90 | AbstractResidue |
struc['A'][50]["CA"] |
Model 1, chain A, residue 50, atom name CA | AbstractAtom |
struc['A'][15]["CG"]['A'] |
For disordered atoms, access a specific location | Atom |
Disordered atoms are stored in a DisorderedAtom
container but calls fall back to the default atom, so disorder can be ignored if you are not interested in it.
Disordered residues (i.e. point mutations with different residue names) are stored in a DisorderedResidue
container.
The idea is that disorder will only bother you if you want it to. See the Biopython discussion for more.
Properties can be retrieved as follows:
Function | Returns | Return type |
---|---|---|
serial |
Serial number of an atom | Int |
atomname |
Name of an atom | String |
altlocid |
Alternative location ID of an atom | Char |
x |
x coordinate of an atom | Float64 |
y |
y coordinate of an atom | Float64 |
z |
z coordinate of an atom | Float64 |
coords |
coordinates of an atom | Array{Float64,1} |
occupancy |
Occupancy of an atom (default is 1.0 ) |
Float64 |
tempfactor |
Temperature factor of an atom (default is 0.0 ) |
Float64 |
element |
Element of an atom (default is " " ) |
String |
charge |
Charge of an atom (default is " " ) |
String |
residue |
Residue an atom belongs to | Residue |
ishetero |
true if the residue or atom is a hetero residue/atom |
Bool |
isdisorderedatom |
true if the atom is disordered |
Bool |
pdbline |
PDB ATOM/HETATM record for an atom | String |
resname |
Residue name of a residue or atom | String |
resnumber |
Residue number of a residue or atom | Int |
inscode |
Insertion code of a residue or atom | Char |
resid |
Residue ID of an atom or residue (full=true includes chain) |
String |
atomnames |
Atom names of the atoms in a residue, sorted by serial | Array{String,1} |
atoms |
Dictionary of atoms in a residue | Dict{String, AbstractAtom} |
isdisorderedres |
true if the residue has multiple residue names |
Bool |
disorderedres |
Access a particular residue name in a DisorderedResidue |
Residue |
chain |
Chain a residue or atom belongs to | Chain |
chainid |
Chain ID of a chain, residue or atom | Char |
resids |
Sorted residue IDs in a chain | Array{String,1} |
residues |
Dictionary of residues in a chain | Dict{String, AbstractResidue} |
model |
Model a chain, residue or atom belongs to | Model |
modelnumber |
Model number of a model, chain, residue or atom | Int |
chainids |
Sorted chain IDs in a model or structure | Array{Char,1} |
chains |
Dictionary of chains in a model or structure | Dict{Char, Chain} |
structure |
Structure a model, chain, residue or atom belongs to | ProteinStructure |
structurename |
Name of the structure an element belongs to | String |
modelnumbers |
Sorted model numbers in a structure | Array{Int,1} |
models |
Dictionary of models in a structure | Dict{Int, Model} |
The strip
keyword argument determines whether surrounding whitespace is stripped for atomname
, element
, charge
, resname
and atomnames
(default true
).
The coordinates of an atom can be set using x!
, y!
, z!
and coords!
.
Manipulating structures
Elements can be looped over to reveal the sub-elements in the correct order:
for mod in struc for ch in mod for res in ch for at in res # Do something end end end end
Models are ordered numerically; chains are ordered by character, except the empty chain is last; residues are ordered by residue number and insertion code with hetero residues after standard residues; atoms are ordered by atom serial.
collect
can be used to get arrays of sub-elements. collectatoms
, collectresidues
, collectchains
and collectmodels
return arrays of a particular type from a structural element or element array.
Selectors are functions passed as additional arguments to these functions. Only elements that return true
when passed to the selector are retained. For example:
Command | Action | Return type |
---|---|---|
collect(struc['A'][50]) |
Collect the sub-elements of an element, e.g. atoms from a residue | Array{AbstractAtom,1} |
collectresidues(struc) |
Collect the residues of an element | Array{AbstractResidue,1} |
collectatoms(struc) |
Collect the atoms of an element | Array{AbstractAtom,1} |
collectatoms(struc, calphaselector) |
Collect the C-alpha atoms of an element | Array{AbstractAtom,1} |
collectatoms(struc, calphaselector, disorderselector) |
Collect the disordered C-alpha atoms of an element | Array{AbstractAtom,1} |
The selectors available are:
Function | Acts on | Selects for |
---|---|---|
standardselector | AbstractAtom or AbstractResidue |
Atoms/residues arising from standard (ATOM) records |
heteroselector | AbstractAtom or AbstractResidue |
Atoms/residues arising from hetero (HETATM) records |
atomnameselector | AbstractAtom |
Atoms with atom name in a given list |
calphaselector | AbstractAtom |
C-alpha atoms |
cbetaselector | AbstractAtom |
C-beta atoms, or C-alpha atoms for glycine residues |
backboneselector | AbstractAtom |
Atoms in the protein backbone (CA, N and C) |
heavyatomselector | AbstractAtom |
Non-hydrogen atoms |
hydrogenselector | AbstractAtom |
Hydrogen atoms |
resnameselector | AbstractAtom or AbstractResidue |
Atoms/residues with residue name in a given list |
waterselector | AbstractAtom or AbstractResidue |
Atoms/residues with residue name HOH |
notwaterselector | AbstractAtom or AbstractResidue |
Atoms/residues with residue name not HOH |
disorderselector | AbstractAtom or AbstractResidue |
Atoms/residues with alternative locations |
It is easy to define your own atom, residue, chain or model selectors. The below will collect all atoms with x coordinate less than 0:
xselector(at::AbstractAtom) = x(at) < 0 collectatoms(struc, xselector)
Alternatively, you can use an anonymous function:
collectatoms(struc, at -> x(at) < 0)
countatoms
, countresidues
, countchains
and countmodels
can be used to count elements. For example:
julia> countatoms(struc) 754 julia> countatoms(struc, calphaselector) 85 julia> countresidues(struc, standardselector) 85
The sequence of a protein can be retrieved by passing a Chain
or array of residues to AminoAcidSequence
:
julia> AminoAcidSequence(struc['A'], standardselector) 85aa Amino Acid Sequence: RCGSQGGGSTCPGLRCCSIWGWCGDSEPYCGRTCENKCWSGERSDHRCGAAVGNPPCGQDRCCSVHGWCGGGNDYCSGGNCQYRC
Writing PDB files
PDB format files can be written:
writepdb("1EN2_out.pdb", struc)
Any element type can be given as input to writepdb
. Atom selectors can also be given as additional arguments:
writepdb("1EN2_out.pdb", struc, backboneselector)
Spatial calculations
Various functions are provided to calculate spatial quantities for proteins:
Command | Returns |
---|---|
distance |
Minimum distance between two elements |
sqdistance |
Minimum square distance between two elements |
bondangle |
Angle between three atoms |
dihedralangle |
Dihedral angle defined by four atoms |
omegaangle |
Omega angle between a residue and the previous residue |
phiangle |
Phi angle between a residue and the previous residue |
psiangle |
Psi angle between a residue and the next residue |
ramachandranangles |
Vector s of phi and psi angles of an element |
contactmap |
Contact map of two elements, or one element with itself |
rmsd |
RMSD between two elements of the same size - assumes they are superimposed |
displacements |
Vector of displacements between two elements of the same size - assumes they are superimposed |
For example:
julia> distance(struc['A'][10], struc['A'][20]) 10.782158874733762 julia> rad2deg(bondangle(struc['A'][50]["N"], struc['A'][50]["CA"], struc['A'][50]["C"])) 110.77765846083398 julia> rad2deg(dihedralangle(struc['A'][50]["N"], struc['A'][50]["CA"], struc['A'][50]["C"], struc['A'][51]["N"])) -177.38288114072924 julia> rad2deg(psiangle(struc['A'][50], struc['A'][51])) -177.38288114072924
Examples
A few further examples of Bio.Structure
usage are given below.
A) To plot the temperature factors of a protein, if you have Gadfly installed:
using Gadfly calphas = collectatoms(struc, calphaselector) plot(x=resnumber.(calphas), y=tempfactor.(calphas), Guide.xlabel("Residue number"), Guide.ylabel("Temperature factor"), Geom.line)
B) To print the PDB records for all C-alpha atoms within 5 Angstroms of residue 38:
for at in calphas if distance(struc['A'][38], at) < 5.0 && resnumber(at) != 38 println(pdbline(at)) end end
D) To view the contact map of a structure:
cbetas = collectatoms(struc, cbetaselector) contacts = contactmap(cbetas, 7.0) for i in 1:length(cbetas) for j in 1:length(cbetas) if contacts[i,j] print("█") else print(" ") end end println() end
contactmap
can also be given two structural elements as arguments, in which case a non-symmetrical 2D array is returned showing contacts between the elements.
E) To show the Ramachandran phi/psi angle plot of a structure, if you have Gadfly installed:
using Gadfly phi_angles, psi_angles = ramachandranangles(struc, standardselector) plot(x=rad2deg.(phi_angles), y=rad2deg.(psi_angles), Guide.xlabel("Phi / degrees"), Guide.ylabel("Psi / degrees"), Guide.xticks(ticks=[-180,-90,0,90,180]), Guide.yticks(ticks=[-180,-90,0,90,180]))
F) To calculate the RMSD and displacements between the heavy (non-hydrogen) atoms of two models in an NMR structure:
downloadpdb("1SSU") struc_nmr = read("1SSU.pdb", PDB) rmsd(struc_nmr[5], struc_nmr[10], heavyatomselector) displacements(struc_nmr[5], struc_nmr[10], heavyatomselector)